PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G041900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 465aa    MW: 51521.2 Da    PI: 4.8076
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G041900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS221.54.3e-681004622374
                GRAS   2 velLlecAeavssgdlelaqalLarlsel.....aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                          +lLl+ Aeav++gd +la+ + ++l +l      + + + + Rla +f+++L++r+++ +s +y   pp++     +s +++++++ +e+
  Sevir.8G041900.1.p 100 SDLLLTGAEAVEAGDSSLASVVFSKLDDLlhvtcENAATSCFDRLAYHFAQGLQSRMSGACSPCY---PPEPV----QSGTMSVHQMIQEL 183
                         689**********************999877553334446899****************777777...44444....45667888999*** PP

                GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                         sP++kf+h+taNqaIl+a+ g+  vH+iDf++++G+QWp+L+  La +  g  s+ +T++   +  ++++ ++ ++ La+fAe+l++pf++
  Sevir.8G041900.1.p 184 SPFVKFTHFTANQAILDATTGNMDVHVIDFNLGEGVQWPSLMSDLARQ--GGKSFHLTAIITDADYNNNTHHTAARCLAEFAESLNLPFQY 272
                         **********************************************85..66799*******776688888888888************** PP

                GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlq.lhrlldesvsleserdevLklvkslsPkvvvvveqe.......adhnsesFlerfleal 261
                         + +  ++ edl  e+++ + + +++V++    l + l  + +l   +  +L +vk+l+P++vv++e+e       a++ ++sF+e f+eal
  Sevir.8G041900.1.p 273 SSVCIHNKEDL--EDFSRNLEGSVVVSCDTTnLCYKL--RNKL---QMLLLGCVKKLQPTLVVIIEEElvgfgkeASLAQGSFVEFFFEAL 356
                         **977777766..8998888999***99873133333..3333...4489****************996555444555666********** PP

                GRAS 262 eyysalfdsleaklpreseer...ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                         ++++++f+sl++ + r s++r   + vEr ++g++i++ va+ g+       tle   + l   GF + +ls ++ +qa++l   ++ + +
  Sevir.8G041900.1.p 357 HHFTTVFESLSSCF-RSSSNRiflRLVERDMVGPKIQDFVAQYGSV------TLEAPPRNL--EGFMSCELSARNIAQARMLAGLFN-RSF 437
                         **********9998.555555122579******************8......555555555..6***********************.66* PP

                GRAS 350 rveeesgslvlgWkdrpLvsvSaWr 374
                          + +e+g l l+Wk+rpL+svS+W+
  Sevir.8G041900.1.p 438 GIAHEKGRLQLCWKSRPLISVSVWT 462
                         ************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098531.95773443IPR005202Transcription factor GRAS
PfamPF035141.5E-65100462IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
METMSYPCSP LLSFPIHEES CYPLWSPEVA CHENSPVDPS PYHHEDCELF DTIATDSSDT  60
HGQNAFGVDA LTHRHEKLLR QENGNLAAIQ EELMEENSLS DLLLTGAEAV EAGDSSLASV  120
VFSKLDDLLH VTCENAATSC FDRLAYHFAQ GLQSRMSGAC SPCYPPEPVQ SGTMSVHQMI  180
QELSPFVKFT HFTANQAILD ATTGNMDVHV IDFNLGEGVQ WPSLMSDLAR QGGKSFHLTA  240
IITDADYNNN THHTAARCLA EFAESLNLPF QYSSVCIHNK EDLEDFSRNL EGSVVVSCDT  300
TNLCYKLRNK LQMLLLGCVK KLQPTLVVII EEELVGFGKE ASLAQGSFVE FFFEALHHFT  360
TVFESLSSCF RSSSNRIFLR LVERDMVGPK IQDFVAQYGS VTLEAPPRNL EGFMSCELSA  420
RNIAQARMLA GLFNRSFGIA HEKGRLQLCW KSRPLISVSV WTPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2413246128374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980190.20.0PREDICTED: uncharacterized protein LOC101766196
TrEMBLK3ZN080.0K3ZN08_SETIT; Uncharacterized protein
STRINGSi027981m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76843250
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.13e-41GRAS family protein